"IGSF8" Related Products

Expand
Expand

Recombinant Human IGSF8, His-tagged

Cat.No.: IGSF8-29100TH
Product Overview: Recombinant fragment, corresponding to amino acids 185-613 of Human IGSF8 with an N terminal His tag. Predicted mwt: 46 kDa;
Description: This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile)-motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 128 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRS DLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQA GDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQT LSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAA YSVGWEMAPAGAPGPGRLVAQLDTEGVGSLGPGYEGRH IAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSG TRLREAASARSRPLPVHVREEGVVLEAVAWLAGGTVYR GETASLLCNISVRGGPPGLRLAASWWVERPEDGELSSVPA QLVGGVGQDGVAELGVRPGGGPVSVELVGPRSHRLRLH SLGPEDEGVYHCAPSAWVQHADYSWYQAGSARSGPVTV YPYMHALDTLFVPLLVGTGVALVTGATVLGTITCCFMKRLRKR
Gene Name: IGSF8 immunoglobulin superfamily, member 8 [ Homo sapiens ]
Official Symbol: IGSF8
Synonyms: IGSF8; immunoglobulin superfamily, member 8; immunoglobulin superfamily member 8; CD81P3; CD316; EWI2; PGRL;
Gene ID: 93185
mRNA Refseq: NM_052868
Protein Refseq: NP_443100
MIM: 606644
Uniprot ID: Q969P0
Chromosome Location: 1q23.1
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.