Recombinant Human IKBKB

• Cat.No.: IKBKB-28877TH
• Product Overview: Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa.

Specification

• Description: The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene.
• Protein length: 256 amino acids
• Molecular Weight: 53.790kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in heart, placenta, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis and peripheral blood.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS
• Sequence Similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.Contains 1 protein kinase domain.

Gene Information

• Gene Name: IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ]
• Official Symbol: IKBKB
• Synonyms: IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB
• Gene ID: 3551
• mRNA Refseq: NM_001190720
• Protein Refseq: NP_001177649
• MIM: 603258
• Uniprot ID: O14920
• Chromosome Location: 8p11.2
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem
• Function: ATP binding; IkappaB kinase activity; nucleotide binding; protein binding; protein kinase activity