Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human IL13

Cat.No. : IL13-28497TH
Product Overview : Full length Human Recombinant IL13 is a single, non-glycosylated polypeptide chain containing 112 amino acids. M.Wt 12 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Source : E. coli
Form : Lyophilised:Reconstitutein sterile 18MOhm/cm water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS, pH 7.2
Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Sequence Similarities : Belongs to the IL-4/IL-13 family.
Gene Name : IL13 interleukin 13 [ Homo sapiens ]
Official Symbol : IL13
Synonyms : IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600;
Gene ID : 3596
mRNA Refseq : NM_002188
Protein Refseq : NP_002179
MIM : 147683
Uniprot ID : P35225
Chromosome Location : 5q31
Pathway : Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem;
Function : cytokine activity; interleukin-13 receptor binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
How does flow cytometry help quantify IL13 receptor expression on different cell populations? 12/29/2022

Flow cytometry quantifies IL13 receptor expression on cells.

What are the benefits of using transgenic animal models to study IL13's in vivo functions? 07/05/2022

Transgenic models illuminate IL13's in vivo functions.

Could you explain the role of ELISA in quantifying IL13 secretion levels in cell cultures? 02/23/2022

ELISA quantifies IL13 secretion in cell cultures accurately.

How can siRNA knockdown experiments reveal IL13's effects on specific cellular processes? 06/13/2021

siRNA knockdown uncovers IL13's specific cellular effects.

How does co-immunoprecipitation identify interacting partners in IL13-mediated signaling complexes? 07/28/2019

Co-immunoprecipitation identifies IL13 signaling partners.

What techniques can differentiate IL13-mediated signaling pathways from IL4 pathways? 07/23/2019

Differential techniques distinguish IL13 and IL4 signaling pathways.

Could you elaborate on the use of reporter gene assays to assess IL13-driven transcriptional activity? 12/16/2018

Reporter gene assays gauge IL13-driven transcription.

Can you describe the applications of microarray analysis in profiling IL13-induced gene expression changes? 11/14/2018

Microarray analysis profiles IL13-induced gene expression.

What experimental methods determine the impact of IL13 on tissue remodeling processes? 08/04/2018

Experimental methods reveal IL13's impact on tissue remodeling.

How does site-directed mutagenesis help identify critical residues in IL13 receptor binding? 07/04/2018

Site-directed mutagenesis identifies key residues in IL13 receptor binding.

Customer Reviews (3)

Write a review
Reviews
11/29/2021

    Effective in Th2 cell differentiation.

    04/22/2020

      Good for cytokine assays.

      01/26/2019

        High yield in expression.

        Ask a Question for All IL13 Products

        Required fields are marked with *

        My Review for All IL13 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends