"IL7R" Related Products

Expand
Expand
Expand

Recombinant Human IL7R

Cat.No.: IL7R-29272TH
Product Overview: Recombinant fragment, corresponding to amino acids 21-236 of Human IL7R alpha fused to the Fc region of Human IgG1 expressed in modified Human 293 cells.
Description: The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID).
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:ESGYAQNGDLEDAELDDYSFSCYSQLEVN GSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRK LQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIV KPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMH DVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKV RSIPDHYFKGFWSEWSPSYYFRTPEINNSSGGIPKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK
Sequence Similarities: Belongs to the type I cytokine receptor family. Type 4 subfamily.Contains 1 fibronectin type-III domain.
Gene Name: IL7R interleukin 7 receptor [ Homo sapiens ]
Official Symbol: IL7R
Synonyms: IL7R; interleukin 7 receptor; interleukin-7 receptor subunit alpha; CD127;
Gene ID: 3575
mRNA Refseq: NM_002185
Protein Refseq: NP_002176
MIM: 146661
Uniprot ID: P16871
Chromosome Location: 5p13
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; IL-7 Signaling Pathway, organism-specific biosystem;
Function: antigen binding; interleukin-7 receptor activity; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.