"ING2" Related Products

Expand
Expand

Recombinant Human ING2

Cat.No.: ING2-28777TH
Product Overview: Recombinant full length protein of Human ING2 with a N terminal proprietary tag; Predicted MWt 56.91kDa including the tag.
Description: This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis.
Protein length: 280 amino acids
Molecular Weight: 56.910kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed. Higher expressed in colon-cancer tumor than in normal colon tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPH DMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKK RLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMEL HSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSES RDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREA SPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHF SCVSLTYKPKGKWYCPKCRGDNEKTMGKSTEKTKKDRRSR
Sequence Similarities: Belongs to the ING family.Contains 1 PHD-type zinc finger.
Gene Name: ING2 inhibitor of growth family, member 2 [ Homo sapiens ]
Official Symbol: ING2
Synonyms: ING2; inhibitor of growth family, member 2; ING1L, inhibitor of growth family, member 1 like; inhibitor of growth protein 2; p33ING2;
Gene ID: 3622
mRNA Refseq: NM_001564
Protein Refseq: NP_001555
MIM: 604215
Uniprot ID: Q9H160
Chromosome Location: 4q35.1
Pathway: Senescence and Autophagy, organism-specific biosystem;
Function: DNA binding; chromatin binding; metal ion binding; methylated histone residue binding; phosphatidylinositol binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.