"IRAK1BP1" Related Products

Expand
Expand

Recombinant Human IRAK1BP1, His-tagged

Cat.No.: IRAK1BP1-27501TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-260 of Human IRAK1BP1 with N terminal His tag, 34kDa.
Description: IRAK1BP1 is a component of the IRAK1 dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. It acts by enhancing RELA transcriptional activity.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHP LSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTK EAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVIS PPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVG QTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL
Gene Name: IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens ]
Official Symbol: IRAK1BP1
Synonyms: IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL;
Gene ID: 134728
mRNA Refseq: NM_001010844
Protein Refseq: NP_001010844
Uniprot ID: Q5VVH5
Chromosome Location: 6q14-q15

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.