"IRF5" Related Products

Expand
Expand
Expand

Recombinant Human IRF5

Cat.No.: IRF5-28725TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-498 of Human IRF5, with an N-terminal proprietary tag, 80.89 kDa inclusive of tag
Description: This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment.
Protein length: 498 amino acids
Molecular Weight: 80.890kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEK KLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDE ADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEV CSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLT EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL APPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI SPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDV LDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFG EEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADS IRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPG AGLGVGQGPWPMHPAGMQ
Sequence Similarities: Belongs to the IRF family.Contains 1 IRF tryptophan pentad repeat DNA-binding domain.
Gene Name: IRF5 interferon regulatory factor 5 [ Homo sapiens ]
Official Symbol: IRF5
Synonyms: IRF5; interferon regulatory factor 5;
Gene ID: 3663
mRNA Refseq: NM_001098627
Protein Refseq: NP_001092097
MIM: 607218
Uniprot ID: Q13568
Chromosome Location: 7q32
Pathway: Apoptosis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function: regulatory region DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.