"KCTD4" Related Products

Expand

Recombinant Human KCTD4

Cat.No.: KCTD4-28457TH
Product Overview: Recombinant Full Length Human KCTD4 produced in Saccharomyces cerevisiae; 259 amino acids, MWt 30kDa. Protein is tagged with 26 kDa proprietary tag.
Description: KCTD4 contains a potassium channel tetramerisation domain. The N terminal, cytoplasmic tetramerisation domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily specific assembly of alpha subunits into functional tetrameric channels. The specific function of KCTD4 is unknown.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVG GYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYF IDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLR IFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNII QFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
Gene Name: KCTD4 potassium channel tetramerisation domain containing 4 [ Homo sapiens ]
Official Symbol: KCTD4
Synonyms: KCTD4; potassium channel tetramerisation domain containing 4; BTB/POZ domain-containing protein KCTD4; bA321C24.3;
Gene ID: 386618
mRNA Refseq: NM_198404
Protein Refseq: NP_940686
Uniprot ID: Q8WVF5
Chromosome Location: 13q14.12-q14.13
Function: voltage-gated potassium channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.