Recombinant Human LBP
Cat.No. : | LBP-29046TH |
Product Overview : | Recombinant full length Human LBP with N terminal proprietary tag, 75.83kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found on chromosome 20, immediately downstream of the BPI gene. |
Protein length : | 452 amino acids |
Molecular Weight : | 75.830kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGD LRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSI SDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISVDLLLG SESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQI ESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAA VMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITD DMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPS APLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVAT NVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLE ALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQI HKDFPSRRDHPP |
Sequence Similarities : | Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family. |
Gene Name : | LBP lipopolysaccharide binding protein [ Homo sapiens ] |
Official Symbol : | LBP |
Synonyms : | LBP; lipopolysaccharide binding protein; lipopolysaccharide-binding protein; BPI fold containing family D; member 2; BPIFD2; |
Gene ID : | 3929 |
mRNA Refseq : | NM_004139 |
Protein Refseq : | NP_004130 |
MIM : | 151990 |
Uniprot ID : | P18428 |
Chromosome Location : | 20q11.23 |
Pathway : | IL6-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; LPS transferred from LBP carrier to CD14, organism-specific biosystem; Salmonella infection, organism-specific biosystem; |
Function : | Gram-negative bacterial cell surface binding; Gram-negative bacterial cell surface binding; Gram-positive bacterial cell surface binding; cell surface binding; lipid binding; |
Products Types
◆ Recombinant Protein | ||
Lbp-5009M | Recombinant Mouse Lbp Protein, His (Fc)-Avi-tagged | +Inquiry |
Lbp-5007M | Recombinant Mouse Lbp Protein, His (Fc)-Avi-tagged | +Inquiry |
LBP-821H | Recombinant Human LBP Protein | +Inquiry |
LBP-5008M | Recombinant Mouse LBP Protein, His (Fc)-Avi-tagged | +Inquiry |
LBP-3339H | Recombinant Human LBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
LBP-1853HCL | Recombinant Human LBP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket