"LCN1" Related Products

Expand
Expand

Recombinant Human LCN1

Cat.No.: LCN1-29220TH
Product Overview: Recombinant full length Human LCN1 (amino acids 1-176) with N terminal proprietary tag, 45.43 kDa.
Description: The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception.
Protein length: 176 amino acids
Molecular Weight: 45.430kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAM TVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQ EVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE GELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTE SILIPRQSETCSPGSD
Sequence Similarities: Belongs to the calycin superfamily. Lipocalin family.
Gene Name: LCN1 lipocalin 1 [ Homo sapiens ]
Official Symbol: LCN1
Synonyms: LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TP; VEGP; Von Ebner gland protein;
Gene ID: 3933
mRNA Refseq: NM_002297
Protein Refseq: NP_002288
MIM: 151675
Uniprot ID: P31025
Chromosome Location: 9q34
Function: binding; cysteine-type endopeptidase inhibitor activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.