"LIG3" Related Products

Expand

Recombinant Human LIG3 protein, His-tagged

Cat.No.: Lig3-26931TH
Product Overview: Recombinant fragment, corresponding to amino acids 328-949 of Human DNA Ligase III with an N terminal His tag. Predicted MWt: 70 kDa.
Description: This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Source: E. coli
Species: Human
Tag: His
Form: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
AA Sequence: KLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEV DEFLLRLSKL TKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSG AKHVLDALDPNAYEAFKASRNL QDVVERVLHNAQEVEKEPGQRRALSV QASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEI KYDGERVQVHKNGD HFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNK TG KPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHD NMVEIPNR IMFSEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYE PGKRHWLKVKKDYLNEGAMA DTADLVVLGAFYGQGSKGGMMSIFLMGC YDPGSQKWCTVTKCAGGHDDATLARLQNELDM VKISKDPSKIPSWLKV NKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRC TRIR DDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPS GSAVSR KAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLA TKSSPVKVGEKRKAADET LCQTKRRPASEQRGRTVPAGRR
Storage: Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Reconstitution: Reconstitute with 105 µl aqua dest.
Gene Name: LIG3 ligase III, DNA, ATP-dependent [ Homo sapiens ]
Official Symbol: LIG3
Synonyms: LIG3; ligase III, DNA, ATP-dependent; LIG2, ligase II, DNA, ATP dependent; DNA ligase 3; ligase II, DNA, ATP-dependent; polydeoxyribonucleotide synthase [ATP] 3; LIG2;
Gene ID: 3980
mRNA Refseq: NM_002311
Protein Refseq: NP_002302
MIM: 600940
UniProt ID: P49916
Chromosome Location: 17q11.2-q12
Pathway: BER complex, organism-specific biosystem; BER complex, conserved biosystem; Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; DNA Repair, organism-specific biosystem; Resolution of AP sites via the single-nucleotide replacement pathway, organism-specific biosystem;
Function: ATP binding; DNA binding; DNA ligase (ATP) activity; DNA ligase activity; ligase activity; metal ion binding; nucleotide binding; protein binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.