"LTA" Related Products

Expand
Expand

Recombinant Human LTA

Cat.No.: LTA-31535TH
Product Overview: Recombinant full length protein (Human)
Description: The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis.
Source: E. coli
Form: Lyophilised:Reconstitute with 20μl pure water.
Storage: Store at -20°C, Stable for 6 months at -20°C
Sequences of amino acids: Human TNF-beta is an 18.6 kDa protein containing 172 amino acid residues.:MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLW RANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFS GKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQK MVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPH LVLSPSTVFFGAFAL
Sequence Similarities: Belongs to the tumor necrosis factor family.
Gene Name: LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ]
Official Symbol: LTA
Synonyms: LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1;
Gene ID: 4049
mRNA Refseq: NM_000595
Protein Refseq: NP_000586
MIM: 153440
Uniprot ID: P01374
Chromosome Location: 6p21.3
Pathway: Apoptosis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.