Recombinant Human LTA
Cat.No. : | LTA-31535TH |
Product Overview : | Recombinant full length protein (Human) |
- Specification
- Gene Information
- Related Products
Description : | The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis. |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 20μl pure water. |
Storage : | Store at -20°C, Stable for 6 months at -20°C |
Sequences of amino acids : | Human TNF-beta is an 18.6 kDa protein containing 172 amino acid residues.:MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLW RANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFS GKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQK MVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPH LVLSPSTVFFGAFAL |
Sequence Similarities : | Belongs to the tumor necrosis factor family. |
Gene Name : | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
Official Symbol : | LTA |
Synonyms : | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; |
Gene ID : | 4049 |
mRNA Refseq : | NM_000595 |
Protein Refseq : | NP_000586 |
MIM : | 153440 |
Uniprot ID : | P01374 |
Chromosome Location : | 6p21.3 |
Pathway : | Apoptosis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function : | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
Products Types
◆ Native Protein | ||
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
◆ Lysates | ||
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionLTA protein is being investigated for its potential use in cancer therapy, autoimmune diseases, and infectious diseases.
Clinical trials may have been initiated to investigate the therapeutic potential of LTA protein since my last update. It's advisable to check the latest information.
Potential side effects may include immune-related adverse events, such as inflammation and cytokine release syndrome.
LTA protein has been studied for its potential to modulate autoimmune responses, but more research is needed.
LTA protein has shown potential in cancer immunotherapy by targeting and destroying cancer cells.
Customer Reviews (3)
Write a reviewIts purity, integrity, and functionality are ensured through stringent quality control measures, which instills confidence in the reliability and accuracy of my research results.
Their technical expertise, product quality, customer support, and supply management collectively contribute to the success and progress of my trials.
The manufacturer also offers valuable customer support, actively aiding researchers in their experimental journey.
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *
Inquiry Basket