"MAPK12" Related Products

Expand
Expand

Recombinant Human MAPK12, His-tagged

Cat.No.: MAPK12-31378TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-367 of Human SAPK3, with an N-terminal His tag, 387aa, 44.1 kDa.
Description: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes.
Protein length: 367 amino acids
Conjugation: HIS
Molecular Weight: 44.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Highly expressed in skeletal muscle and heart.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSPPPARSGFYRQEVTKTA WEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLD DFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKG LRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMI TGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKN YMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEW KRVTYKEVLSFKPPRQLGARVSKETPL
Sequence Similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain.
Gene Name: MAPK12 mitogen-activated protein kinase 12 [ Homo sapiens ]
Official Symbol: MAPK12
Synonyms: MAPK12; mitogen-activated protein kinase 12; SAPK3; ERK6; p38gamma; PRKM12; SAPK 3;
Gene ID: 6300
mRNA Refseq: NM_002969
Protein Refseq: NP_002960
MIM: 602399
Uniprot ID: P53778
Chromosome Location: 22q13.3
Pathway: Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function: ATP binding; MAP kinase activity; magnesium ion binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.