Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MBNL1

Cat.No. : MBNL1-30258TH
Product Overview : Recombinant full length Human Muscleblind-like 1 according to AAH50535,with N-terminal proprietary tag.Mol Wt 63.84 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : Muscleblind-like (Drosophila), also known as MBNL1, is a protein that in humans is encoded by the MBNL1 gene. It has been implicated in Myotonic dystrophy and has been shown to autoregulate its transcript.
Protein length : 343 amino acids
Molecular Weight : 63.840kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in cardiac, skeletal muscle and during myoblast differentiation. Weakly expressed in other tissues (at protein level). Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLA QQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYL GPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLM RTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNT VTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQA AAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPL PKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLP PGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAAT ATANQIPIISAEHLTSHKYVTQM
Sequence Similarities : Belongs to the muscleblind family.Contains 4 C3H1-type zinc fingers.
Gene Name : MBNL1 muscleblind-like (Drosophila) [ Homo sapiens ]
Official Symbol : MBNL1
Synonyms : MBNL1; muscleblind-like (Drosophila); MBNL, muscleblind (Drosophila) like; muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428;
Gene ID : 4154
mRNA Refseq : NM_207294
Protein Refseq : NP_997177
MIM : 606516
Uniprot ID : Q9NR56
Chromosome Location : 3q25
Pathway : Adipogenesis, organism-specific biosystem;
Function : RNA binding; double-stranded RNA binding; metal ion binding; nucleic acid binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How does MBNL1 contribute to tissue-specific alternative splicing? 12/07/2022

It contributes to tissue-specific splicing patterns, essential for proper development and function of various tissues.

What are the main functions of MBNL1 in RNA processing? 08/21/2022

MBNL1 regulates alternative splicing, polyadenylation, and localization of mRNAs, impacting gene expression.

What is the role of MBNL1 in the development of muscle tissue? 03/19/2022

MBNL1 plays a key role in muscle development and differentiation, influencing muscle-specific gene expression.

How does MBNL1 dysfunction contribute to myotonic dystrophy? 03/28/2021

In myotonic dystrophy, MBNL1 becomes sequestered by toxic RNA repeats, leading to mis-splicing and muscular dysfunction.

How can MBNL1 activity be modulated for therapeutic purposes? 02/25/2020

Therapeutic modulation of MBNL1 is being explored, focusing on releasing MBNL1 from sequestration and correcting mis-splicing in conditions like myotonic dystrophy.

What are the molecular consequences of MBNL1 sequestration in cells? 11/23/2018

Sequestration of MBNL1 results in altered splicing patterns of numerous genes, contributing to cellular dysfunction.

Are there any known post-translational modifications that regulate MBNL1 activity? 11/07/2018

There is limited information on post-translational modifications regulating MBNL1, necessitating further research.

Customer Reviews (3)

Write a review
Reviews
03/24/2022

    Excellent product, fast delivery.

    04/28/2020

      Reliable for my research.

      10/29/2019

        Worked perfectly, highly recommend.

        Ask a Question for All MBNL1 Products

        Required fields are marked with *

        My Review for All MBNL1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends