"MCAM" Related Products

Expand
Expand
Expand

Recombinant Human MCAM

Cat.No.: MCAM-27836TH
Product Overview: Recombinant full length protein of Human CD146 with proprietary tag; predicted MW 97.17 kDa, inclusive of tag.
Description: CD146 (cluster of differentiation 146) also known as the melanoma cell adhesion molecule (MCAM) or cell surface glycoprotein MUC18, is a 113kDa cell adhesion molecule currently used as a marker for endothelial cell lineage.
Protein length: 646 amino acids
Molecular Weight: 97.170kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progress
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEV GSTALLKCGLSQSQGNLSHVDWFSVHKEKRTLIFRVRQGQ GQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKR PRSQEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVAT CVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSG LYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESRE VTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYEC QGLDLDTMISLLSEPQELLVNYVSDVRVSPAAPERQEGSS LTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKRE AGGGYRCVASVPSIPGLNRTQLVNVAIFGPPWMAFKERKV WVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRV LSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLT TLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITL PPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEK YIDLRH
Sequence Similarities: Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 Ig-like V-type (immunoglobulin-like) domains.
Gene Name: MCAM melanoma cell adhesion molecule [ Homo sapiens ]
Official Symbol: MCAM
Synonyms: MCAM; melanoma cell adhesion molecule; cell surface glycoprotein MUC18; CD146; Gicerin; MUC18;
Gene ID: 4162
mRNA Refseq: NM_006500
Protein Refseq: NP_006491
MIM: 155735
Uniprot ID: P43121
Chromosome Location: 11q23.3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.