"MCRS1" Related Products

Expand

Recombinant Human MCRS1, His-tagged

Cat.No.: MCRS1-30186TH
Product Overview: Recombinant fragment, corresponding to amino acids 14-317 of Human MCRS1 with N terminal His tag; MWt 35 kDa.
Description: MCRS1 (Microspherule protein 1) modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. It also associates with TERT and inhibits telomerase activity.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 61 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIK RKKFDDELVESSLAKSSTRAKGASGVEPGRCSGSEPSS SEKKKVSKAPSTPVPPSPAPAPGLTKRVKKSKQPLQVT KDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFT LREVQERWYALLYDPVISKLACQAMRQLHPEAIAAIQSKA LFSKAEEQLLSKVGSTSQPTLETFQDLLHRHPDAFYLA RTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSD AEDLIDDSKLKDMRDEVLEHELMVADRRQKREIR
Gene Name: MCRS1 microspherule protein 1 [ Homo sapiens ]
Official Symbol: MCRS1
Synonyms: MCRS1; microspherule protein 1; ICP22BP; INO80 complex subunit Q; INO80Q; MCRS2; MSP58; P78;
Gene ID: 10445
mRNA Refseq: NM_001012300
Protein Refseq: NP_001012300
MIM: 609504
Uniprot ID: Q96EZ8
Chromosome Location: 12q13.12
Pathway: Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.