Recombinant Human MDM4
Cat.No. : | MDM4-29757TH |
Product Overview : | Recombinant full length Human MDMX with N terminal proprietary tag; Predicted MWt 79.97 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latters degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Protein length : | 490 amino acids |
Molecular Weight : | 79.970kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in all tissues tested with high levels in thymus. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAA GAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDL LGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPT SEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPW WFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGK NDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYC FRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHS SESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLC EKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE IQLVIKVFIA |
Sequence Similarities : | Belongs to the MDM2/MDM4 family.Contains 1 RanBP2-type zinc finger.Contains 1 RING-type zinc finger.Contains 1 SWIB domain. |
Gene Name : | MDM4 Mdm4 p53 binding protein homolog (mouse) [ Homo sapiens ] |
Official Symbol : | MDM4 |
Synonyms : | MDM4; Mdm4 p53 binding protein homolog (mouse); Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse) , mouse double minute 4, human homolog of; p53 binding protein; protein Mdm4; MDMX; |
Gene ID : | 4194 |
mRNA Refseq : | NM_001204171 |
Protein Refseq : | NP_001191100 |
MIM : | 602704 |
Uniprot ID : | O15151 |
Chromosome Location : | 1q32 |
Pathway : | p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem; |
Function : | enzyme binding; metal ion binding; protein binding; zinc ion binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
MDM4-4493H | Recombinant Human MDM4 Protein, GST-tagged | +Inquiry |
MDM4-5433M | Recombinant Mouse MDM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MDM4-3287R | Recombinant Rat MDM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MDM4-0091H | Recombinant Human MDM4 Protein (T2-A490), His tagged | +Inquiry |
MDM4-0090H | Recombinant Human MDM4 Protein (T2-A490), Tag Free | +Inquiry |
◆ Lysates | ||
MDM4-4403HCL | Recombinant Human MDM4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MDM4 Products
Required fields are marked with *
My Review for All MDM4 Products
Required fields are marked with *
0
Inquiry Basket