"MEN1" Related Products

Expand
Expand

Recombinant Human MEN1

Cat.No.: MEN1-30096TH
Product Overview: Recombinant full length Human Menin with N terminal proprietary tag; Predicted MWt 89.25 kDa including the tag.
Description: This gene encodes menin, a putative tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. In vitro studies have shown menin is localized to the nucleus, possesses two functional nuclear localization signals, and inhibits transcriptional activation by JunD, however, the function of this protein is not known. Two messages have been detected on northern blots but the larger message has not been characterized. Alternative splicing results in multiple transcript variants.
Protein length: 575 amino acids
Molecular Weight: 89.250kDa
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLS LVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYF PVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELV KKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVA FAVVGACQALGLRDVHLALSEDHAWSWLYLKGSYMRCDRK MEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHL ERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYY RDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNY CREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQ SQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLH VGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGE EAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSG PPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTF QSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVS TPSDYTLSFLKRQRKGL
Gene Name: MEN1 multiple endocrine neoplasia I [ Homo sapiens ]
Official Symbol: MEN1
Synonyms: MEN1; multiple endocrine neoplasia I; menin;
Gene ID: 4221
mRNA Refseq: NM_000244
Protein Refseq: NP_000235
MIM: 613733
Uniprot ID: O00255
Chromosome Location: 11q13
Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: DNA binding; R-SMAD binding; Y-form DNA binding; chromatin binding; double-stranded DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.