Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MLANA

Cat.No. : MLANA-30193TH
Product Overview : Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma.
Protein length : 118 amino acids
Molecular Weight : 39.090kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expression is restricted to melanoma and melanocyte cell lines and retina.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Gene Name : MLANA melan-A [ Homo sapiens ]
Official Symbol : MLANA
Synonyms : MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1;
Gene ID : 2315
mRNA Refseq : NM_005511
Protein Refseq : NP_005502
MIM : 605513
Uniprot ID : Q16655
Chromosome Location : 9p24.1
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
How does MLANA interact with other proteins? 12/31/2022

MLANA can interact with a variety of other proteins, including proteins on mitochondrial membranes, members of the Bcl-2 family, and caspases. These interactions allow it to regulate processes such as mitochondrial dynamics and apoptosis.

What role does MLANA play in cancer? 05/13/2022

Studies have shown that the expression level of MLANA is upregulated in some cancers, which may be related to the occurrence and development of tumors. It could be a potential target for cancer treatment.

What's the treatment strategy for MLANA? 03/10/2022

Therapeutic strategies for MLANA include inhibiting its expression, inhibiting its interaction with specific proteins, and targeting degradation. These approaches may have potential applications for certain cancer treatments.

Is there a relationship between the structure and function of MLANA? 12/02/2021

The structure of MLANA determines its ability to interact with other proteins on the mitochondrial membrane and its function. The study of its structure can help us understand its function and mechanism of action.

How is the expression level of MLANA regulated? 11/21/2020

The expression level of MLANA can be regulated in a variety of ways, including transcription, post-transcriptional modification, and degradation. These processes may involve various molecules such as transcription factors, regulatory Rnas, and signal transduction pathways.

How does MLANA participate in mitochondrial homeostasis? 05/24/2020

MLANA can interact with a variety of proteins on the mitochondrial membrane to regulate the fusion and division of mitochondria, thus maintaining the homeostasia of mitochondria.

Customer Reviews (3)

Write a review
Reviews
01/13/2022

    The labeling effect is excellent in Western blot, and fluorescent labeling can be performed.

    01/03/2022

      The stability of MLANA is excellent and adaptable under a variety of conditions.

      04/07/2021

        Good expression level and stability in clonal expression.

        Ask a Question for All MLANA Products

        Required fields are marked with *

        My Review for All MLANA Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends