Recombinant Human MLANA
Cat.No. : | MLANA-30193TH |
Product Overview : | Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa. |
- Specification
- Gene Information
- Related Products
Description : | MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma. |
Protein length : | 118 amino acids |
Molecular Weight : | 39.090kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expression is restricted to melanoma and melanocyte cell lines and retina. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
Gene Name : | MLANA melan-A [ Homo sapiens ] |
Official Symbol : | MLANA |
Synonyms : | MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1; |
Gene ID : | 2315 |
mRNA Refseq : | NM_005511 |
Protein Refseq : | NP_005502 |
MIM : | 605513 |
Uniprot ID : | Q16655 |
Chromosome Location : | 9p24.1 |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
MLANA-1658H | Recombinant Human MLANA Protein (1-118 aa), His-tagged | +Inquiry |
Mlana-4088M | Recombinant Mouse Mlana Protein, Myc/DDK-tagged | +Inquiry |
MLANA-5379H | Recombinant Human MLANA Protein, GST-tagged | +Inquiry |
MLANA-1282H | Recombinant Human MLANA Protein, His-B2M-tagged | +Inquiry |
MLANA-1417H | Recombinant Human MLANA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionMLANA can interact with a variety of other proteins, including proteins on mitochondrial membranes, members of the Bcl-2 family, and caspases. These interactions allow it to regulate processes such as mitochondrial dynamics and apoptosis.
Studies have shown that the expression level of MLANA is upregulated in some cancers, which may be related to the occurrence and development of tumors. It could be a potential target for cancer treatment.
Therapeutic strategies for MLANA include inhibiting its expression, inhibiting its interaction with specific proteins, and targeting degradation. These approaches may have potential applications for certain cancer treatments.
The structure of MLANA determines its ability to interact with other proteins on the mitochondrial membrane and its function. The study of its structure can help us understand its function and mechanism of action.
The expression level of MLANA can be regulated in a variety of ways, including transcription, post-transcriptional modification, and degradation. These processes may involve various molecules such as transcription factors, regulatory Rnas, and signal transduction pathways.
MLANA can interact with a variety of proteins on the mitochondrial membrane to regulate the fusion and division of mitochondria, thus maintaining the homeostasia of mitochondria.
Customer Reviews (3)
Write a reviewThe labeling effect is excellent in Western blot, and fluorescent labeling can be performed.
The stability of MLANA is excellent and adaptable under a variety of conditions.
Good expression level and stability in clonal expression.
Ask a Question for All MLANA Products
Required fields are marked with *
My Review for All MLANA Products
Required fields are marked with *
Inquiry Basket