"MPZ" Related Products

Expand
Expand

Recombinant Human MPZ

Cat.No.: MPZ-29152TH
Product Overview: Recombinant full length Human Myelin Protein Zero protein with an N terminal proprietary tag; predicted mwt: 54.12 kDa inclusive of tag.
Description: This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 and other polyneuropathies.
Protein length: 258 amino acids
Molecular Weight: 54.120kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Found only in peripheral nervous system Schwann cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAI VVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQP EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV PTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAAL QRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK AVSEKKAKGLGESRKDKK
Sequence Similarities: Belongs to the myelin P0 protein family.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: MPZ myelin protein zero [ Homo sapiens ]
Official Symbol: MPZ
Synonyms: MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB;
Gene ID: 4359
mRNA Refseq: NM_000530
Protein Refseq: NP_000521
MIM: 159440
Uniprot ID: P25189
Chromosome Location: 1q22
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function: structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.