"MSH2" Related Products

Expand
Expand
Expand

Recombinant Human MSH2

Cat.No.: MSH2-28793TH
Product Overview: Recombinant fragment corresponding to amino acids 835-934 of Human MSH2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
Sequence Similarities: Belongs to the DNA mismatch repair mutS family.
Gene Name: MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ]
Official Symbol: MSH2
Synonyms: MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1;
Gene ID: 4436
mRNA Refseq: NM_000251
Protein Refseq: NP_000242
MIM: 609309
Uniprot ID: P43246
Chromosome Location: 2p21
Pathway: BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Mismatch repair, organism-specific biosystem;
Function: contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; DNA binding; DNA-dependent ATPase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.