"MX1" Related Products

Expand
Expand
Expand

Recombinant Human MX1

Cat.No.: MX1-26961TH
Product Overview: Recombinant full length Human MX1 (amino acids 1-662) with N terminal proprietary tag; Predicted MWt 98.89 kDa including the tag.
Description: In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. Two transcript variants encoding the same protein have been found for this gene.
Protein length: 662 amino acids
Molecular Weight: 98.890kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENN LCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQS SGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHE LITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKT LIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKC RGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATV PCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY GVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEED IRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQY RGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKL IRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWD FGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKR KFLKERLARLTQARRRLAQFPG
Sequence Similarities: Belongs to the dynamin family.Contains 1 GED domain.
Gene Name: MX1 myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) [ Homo sapiens ]
Official Symbol: MX1
Synonyms: MX1; myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse); myxovirus (influenza) resistance 1, homolog of murine (interferon inducible protein p78); interferon-induced GTP-binding protein Mx1; IFI 78K; MxA;
Gene ID: 4599
mRNA Refseq: NM_001144925
Protein Refseq: NP_001138397
MIM: 147150
Uniprot ID: P20591
Chromosome Location: 21q22.3
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Interferon Signaling, organism-specific biosystem;
Function: GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.