Recombinant Human MYL6B, His-tagged

• Cat.No.: MYL6B-30245TH
• Product Overview: Recombinant fragment, corresponding to amino acids 42-208 of Human MLC1SA with an N terminal His tag; Predicted MWt 20kDa.

Specification

• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 74 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGD GKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKS RRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEG NGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGC INYEAFLKHILSV
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ]
• Official Symbol: MYL6B
• Synonyms: MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a
• Gene ID: 140465
• mRNA Refseq: NM_001199629
• Protein Refseq: NP_001186558
• MIM: 609930
• Uniprot ID: P14649
• Chromosome Location: 12q13.2
• Pathway: Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem
• Function: calcium ion binding; motor activity; protein binding; structural constituent of muscle