Recombinant Human NAA10, His-tagged
Cat.No. : | NAA10-26531TH |
Product Overview : | Recombinant full length Human ARD1A with an N terminal His tag; 255 amino acids with tag, Predicted MWt 28.6 kDa. |
- Specification
- Gene Information
- Related Products
Description : | N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. |
Protein length : | 235 amino acids |
Conjugation : | HIS |
Molecular Weight : | 28.600kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 10% Glycerol, 1.17% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMNIRNARPEDLMNMQHCNLL CLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLA KMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAM IENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPK YYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAI ENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSE VSETTESTDVKDSSEASDSAS |
Sequence Similarities : | Belongs to the acetyltransferase family. ARD1 subfamily.Contains 1 N-acetyltransferase domain. |
Gene Name : | NAA10 N(alpha)-acetyltransferase 10, NatA catalytic subunit [ Homo sapiens ] |
Official Symbol : | NAA10 |
Synonyms : | NAA10; N(alpha)-acetyltransferase 10, NatA catalytic subunit; ARD1, ARD1 homolog A, N acetyltransferase (S. cerevisiae) , ARD1 homolog, N acetyltransferase (S. cerevisiae) , ARD1A; N-alpha-acetyltransferase 10; DXS707; TE2; |
Gene ID : | 8260 |
mRNA Refseq : | NM_003491 |
Protein Refseq : | NP_003482 |
MIM : | 300013 |
Uniprot ID : | P41227 |
Chromosome Location : | Xq28 |
Pathway : | Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; |
Function : | N-acetyltransferase activity; contributes_to acetyltransferase activity; peptide alpha-N-acetyltransferase activity; protein binding; contributes_to ribosome binding; |
Products Types
◆ Recombinant Protein | ||
NAA10-1470H | Recombinant Human NAA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAA10-3237H | Recombinant Human NAA10 protein(Met1-Ser235), His&GST-tagged | +Inquiry |
NAA10-1302H | Recombinant Human NAA10 protein(Met1-Ser235) | +Inquiry |
NAA10-3610H | Recombinant Human NAA10, His-tagged | +Inquiry |
NAA10-193H | Recombinant Human NAA10 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
NAA10-001HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
NAA10-002HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket