Recombinant Human NAE1, His-tagged
Cat.No. : | NAE1-26749TH |
Product Overview : | Recombinant full length Human APPBP1 with N terminal His tag; 557 amino acids with tag, Predicted MWt 62.7 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimers disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 534 amino acids |
Conjugation : | HIS |
Molecular Weight : | 62.700kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Ubiquitous in fetal tissues. Expressed throughout the adult brain. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 1.17% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAQLGKLLKEQKYDRQL RLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSF TIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELN SDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSL RLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPD NALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVI IAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENG APEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINI TKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSG KYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISE KELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMD NPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKL KSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFL GGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL |
Sequence Similarities : | Belongs to the ubiquitin-activating E1 family. ULA1 subfamily. |
Gene Name : | NAE1 NEDD8 activating enzyme E1 subunit 1 [ Homo sapiens ] |
Official Symbol : | NAE1 |
Synonyms : | NAE1; NEDD8 activating enzyme E1 subunit 1; amyloid beta precursor protein binding protein 1 , amyloid beta precursor protein binding protein 1, 59kDa , amyloid beta precursor protein binding protein 1, 59kD , APPBP1; NEDD8-activating enzyme E1 regulato |
Gene ID : | 8883 |
mRNA Refseq : | NM_001018159 |
Protein Refseq : | NP_001018169 |
MIM : | 603385 |
Uniprot ID : | Q13564 |
Chromosome Location : | 16q22 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; |
Function : | contributes_to NEDD8 activating enzyme activity; catalytic activity; nucleotide binding; protein binding; protein heterodimerization activity; |
Products Types
◆ Recombinant Protein | ||
NAE1-2761R | Recombinant Rhesus Macaque NAE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAE1-469C | Recombinant Cynomolgus Monkey NAE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAE1-32H | Recombinant Human NAE1 Protein, His-tagged | +Inquiry |
Nae1-4281M | Recombinant Mouse Nae1 Protein, Myc/DDK-tagged | +Inquiry |
NAE1-417H | Recombinant Human NAE1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
NAE1-3984HCL | Recombinant Human NAE1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All NAE1 Products
Required fields are marked with *
My Review for All NAE1 Products
Required fields are marked with *
0
Inquiry Basket