"NAP1L4" Related Products

Recombinant Human NAP1L4, His-tagged

Cat.No.: NAP1L4-29718TH
Product Overview: Recombinant fragment, corresponding to amino acids 24-375 of Human NAP1L4 with an N terminal His tag. Predicted mwt: 42 kDa;
Description: This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 95 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: TEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAV KRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQP LFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKV VVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQE YDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFT NSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKG KNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNP LKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINP KV
Gene Name: NAP1L4 nucleosome assembly protein 1-like 4 [ Homo sapiens ]
Official Symbol: NAP1L4
Synonyms: NAP1L4; nucleosome assembly protein 1-like 4; NAP2;
Gene ID: 4676
mRNA Refseq: NM_005969
Protein Refseq: NP_005960
MIM: 601651
Uniprot ID: Q99733
Chromosome Location: 11p15.5
Function: unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.