"NCBP1" Related Products

Expand

Recombinant Human NCBP1

Cat.No.: NCBP1-29240TH
Product Overview: Recombinant full length Human NCBP1 with N terminal proprietary tag; Predicted MW 112.97 kDa.
Description: The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5 cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3-end processing, RNA nuclear export, and nonsense-mediated mRNA decay.
Protein length: 790 amino acids
Molecular Weight: 112.970kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGE KSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLP EKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANN YNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEED VPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTE SYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLK KDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDS VYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHC IIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELF QLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYM RLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQD PESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPAN PTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSI LKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFS HSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQM IAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEI LHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRS SDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMI LTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQ YMVTLENLLFTAELDPHILAVFQQFCALQA
Sequence Similarities: Belongs to the NCBP1 family.Contains 1 MIF4G domain.
Gene Name: NCBP1 nuclear cap binding protein subunit 1, 80kDa [ Homo sapiens ]
Official Symbol: NCBP1
Synonyms: NCBP1; nuclear cap binding protein subunit 1, 80kDa; NCBP, nuclear cap binding protein subunit 1, 80kD; nuclear cap-binding protein subunit 1; CBP80; Sto1;
Gene ID: 4686
mRNA Refseq: NM_002486
Protein Refseq: NP_002477
MIM: 600469
Uniprot ID: Q09161
Chromosome Location: 9q34.1
Pathway: Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Cap binding complex, organism-specific biosystem; Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem;
Function: RNA binding; RNA cap binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.