Recombinant Human NCF4

• Cat.No.: NCF4-29348TH
• Product Overview: Recombinant full length human NCF4 produced in Saccharomyces cerevisiae; amino acids 1-339 , 39kDa.

Specification

• Description: The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Tissue specificity: Expression is restricted to hematopoietic cells.
• Form: Liquid
• Purity: Immunogen affinity purified
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFV FVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSS ALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSV SPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL SRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLF PWKLHITQKDNYRVYNTMP
• Sequence Similarities: Contains 1 PX (phox homology) domain.Contains 1 SH3 domain.

Gene Information

• Gene Name: NCF4 neutrophil cytosolic factor 4, 40kDa [ Homo sapiens ]
• Official Symbol: NCF4
• Synonyms: NCF4; neutrophil cytosolic factor 4, 40kDa; neutrophil cytosolic factor 4 (40kD); neutrophil cytosol factor 4; neutrophil NADPH oxidase factor 4; p40phox; SH3PXD4
• Gene ID: 4689
• mRNA Refseq: NM_000631
• Protein Refseq: NP_000622
• MIM: 601488
• Uniprot ID: Q15080
• Chromosome Location: 22q13.1
• Pathway: Leishmaniasis, organism-specific biosystem; Leishmaniasis, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Osteoclast differentiation, organism-specific biosystem
• Function: phosphatidylinositol binding; protein binding; protein dimerization activity