"NDUFA10" Related Products

Expand

Recombinant Human NDUFA10, His-tagged

Cat.No.: NDUFA10-28707TH
Product Overview: Recombinant fragment, corresponding to amino acids 171-355 of Human NDUFA10 with N terminal His tag; MWt 24kDa;
Description: The protein encoded by this gene belongs to the complex I 42kDA subunit family. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. This protein is a component of the hydrophobic protein fraction and has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 65 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPE MSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQ DNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDR VLHQFRELPGRKYSPGYNTEVGDKWIWLK
Gene Name: NDUFA10 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa [ Homo sapiens ]
Official Symbol: NDUFA10
Synonyms: NDUFA10; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (42kD); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial; CI 42k; complex I 42kDa subunit;
Gene ID: 4705
mRNA Refseq: NM_004544
Protein Refseq: NP_004535
MIM: 603835
Uniprot ID: O95299
Chromosome Location: 2q37.3
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: ATP binding; NADH dehydrogenase (ubiquinone) activity; phosphotransferase activity, alcohol group as acceptor;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.