Recombinant Human NDUFA10, His-tagged

• Cat.No.: NDUFA10-28707TH
• Product Overview: Recombinant fragment, corresponding to amino acids 171-355 of Human NDUFA10 with N terminal His tag; MWt 24kDa

Specification

• Description: The protein encoded by this gene belongs to the complex I 42kDA subunit family. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. This protein is a component of the hydrophobic protein fraction and has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 65 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPE MSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQ DNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDR VLHQFRELPGRKYSPGYNTEVGDKWIWLK

Gene Information

• Gene Name: NDUFA10 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa [ Homo sapiens ]
• Official Symbol: NDUFA10
• Synonyms: NDUFA10; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (42kD); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial; CI 42k; complex I 42kDa subunit
• Gene ID: 4705
• mRNA Refseq: NM_004544
• Protein Refseq: NP_004535
• MIM: 603835
• Uniprot ID: O95299
• Chromosome Location: 2q37.3
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem
• Function: ATP binding; NADH dehydrogenase (ubiquinone) activity; phosphotransferase activity, alcohol group as acceptor