"NDUFA9" Related Products

Expand
Expand

Recombinant Human NDUFA9

Cat.No.: NDUFA9-28706TH
Product Overview: Recombinant full length Human NDUFA9 with N terminal proprietary tag, 69.5kDa.
Description: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12.
Protein length: 377 amino acids
Molecular Weight: 69.500kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHAL MPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQV IIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAG VEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAII VKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKD
Sequence Similarities: Belongs to the complex I NDUFA9 subunit family.
Gene Name: NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ]
Official Symbol: NDUFA9
Synonyms: NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR
Gene ID: 4704
mRNA Refseq: NM_005002
Protein Refseq: NP_004993
MIM: 603834
Uniprot ID: Q16795
Chromosome Location: 12p13.3
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; NADH dehydrogenase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.