Recombinant Human NEFL, His-tagged

• Cat.No.: NEFL-26033TH
• Product Overview: Recombinant fragment, corresponding to amino acids 391-543 of Human 68kDa Neurofilament, with a N-terminal His tag. MWt 37kDa

Specification

• Description: Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 139 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTS SYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKD EPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAK EEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD
• Sequence Similarities: Belongs to the intermediate filament family.

Gene Information

• Gene Name: NEFL neurofilament, light polypeptide [ Homo sapiens ]
• Official Symbol: NEFL
• Synonyms: NEFL; neurofilament, light polypeptide; neurofilament, light polypeptide 68kDa; neurofilament light polypeptide; CMT1F; CMT2E; NF68; NFL
• Gene ID: 4747
• mRNA Refseq: NM_006158
• Protein Refseq: NP_006149
• MIM: 162280
• Uniprot ID: P07196
• Chromosome Location: 8p21.2
• Pathway: Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem
• Function: identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton