"NFKB1" Related Products

Expand
Expand
Expand

Recombinant Human NFKB1

Cat.No.: NFKB1-30383TH
Product Overview: Recombinant full length protein of Human NFkB p105 / p50 with proprietary tag; predicted MW 132.66 kDa, inclusive of tag.
Description: This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 968 amino acids
Molecular Weight: 132.660kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTA DGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKK SYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTE ACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQA ALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYK DINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGS TGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTES KKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNG EVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDY AVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLV RDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVE DLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKK AALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNA QEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDS WENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTS DDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQM GYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELR DSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYG QEGPLEGKI
Sequence Similarities: Contains 7 ANK repeats.Contains 1 death domain.Contains 1 RHD (Rel-like) domain.
Gene Name: NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ]
Official Symbol: NFKB1
Synonyms: NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NFkappaB; NFKB p50; p50; p105;
Gene ID: 4790
mRNA Refseq: NM_001165412
Protein Refseq: NP_001158884
MIM: 164011
Uniprot ID: P19838
Chromosome Location: 4q24
Pathway: Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem;
Function: nucleic acid binding transcription factor activity; protein binding; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.