"NIT2" Related Products

Expand
Expand

Recombinant Human NIT2

Cat.No.: NIT2-26962TH
Product Overview: Recombinant full length Human NIT2 expressed in Saccharomyces cerevisiae; 276 amino acids, MWt 30.6 kDa. Protein is tagged with a 26 kDa proprietary tag.
Description: Omega-amidase NIT2, also known NIT2, belongs to the nitrilase superfamily. This protein has an omega-amidase activity.
Tissue specificity: Detected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVS LPECFNSPYGAKYFPEYAEKIPGESTQKLSEVAKECSI YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDM RFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRS RAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVE MKKP
Sequence Similarities: Belongs to the UPF0012 family.Contains 1 CN hydrolase domain.
Gene Name: NIT2 nitrilase family, member 2 [ Homo sapiens ]
Official Symbol: NIT2
Synonyms: NIT2; nitrilase family, member 2; omega-amidase NIT2;
Gene ID: 56954
mRNA Refseq: NM_020202
Protein Refseq: NP_064587
Uniprot ID: Q9NQR4
Chromosome Location: 3q12.3
Pathway: Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem;
Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; molecular_function; omega-amidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.