Recombinant Human NKIRAS2, His-tagged
Cat.No. : | NKIRAS2-27758TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 52-191 of Human NKIRAS2 with N terminal His tag; Predicted MWt 17 kDa. |
- Specification
- Gene Information
- Related Products
Description : | NKIRAS2 (NF-kappa-B inhibitor-interacting Ras-like protein 2) is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity. It interacts with the PEST domain of NF-kappa-B inhibitor beta (NFKBIB) decreasing the rate of degradation. It may act by blocking phosphorylation of NFKBIB. There are two different isoforms. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSR ESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRR VDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASK MTQPQSKSAFPLSRKNKGSGSLDG |
Gene Name : | NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ] |
Official Symbol : | NKIRAS2 |
Synonyms : | NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2; |
Gene ID : | 28511 |
mRNA Refseq : | NM_001001349 |
Protein Refseq : | NP_001001349 |
MIM : | 604497 |
Uniprot ID : | Q9NYR9 |
Chromosome Location : | 17q21.31 |
Pathway : | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function : | GTP binding; GTPase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
NKIRAS2-2854R | Recombinant Rhesus Macaque NKIRAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKIRAS2-5891H | Recombinant Human NKIRAS2 Protein, GST-tagged | +Inquiry |
Nkiras2-4422M | Recombinant Mouse Nkiras2 Protein, Myc/DDK-tagged | +Inquiry |
NKIRAS2-3035R | Recombinant Rhesus monkey NKIRAS2 Protein, His-tagged | +Inquiry |
NKIRAS2-884Z | Recombinant Zebrafish NKIRAS2 | +Inquiry |
◆ Lysates | ||
NKIRAS2-3817HCL | Recombinant Human NKIRAS2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket