"NKRF" Related Products

Expand
Expand
Expand

Recombinant Human NKRF, His-tagged

Cat.No.: NKRF-29050TH
Product Overview: Recombinant fragment, corresponding to amino acids 299-690 of Human NKRF with a N terminal His tag; predicted MWt 45 kDa:
Description: This gene encodes a transcriptional repressor that interacts with specific negative regulatory elements to mediate transcriptional repression of certain nuclear factor kappa B responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm. Alternate splicing results in multiple transcript variants.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 110 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QIGMSSYEFPPALKPPEDLVVLGKDASGQPIFNASAKHWT NFVITENANDAIGILNNSASFNKMSIEYKYEMMPNRTW RCRVFLQDHCLAEGYGTKKTSKHAAADEALKILQKTQP TYPSVKSSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCT LNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEA VGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDV ISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTGGG LGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQ IIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLK SKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYEL VMPQAN
Gene Name: NKRF NFKB repressing factor [ Homo sapiens ]
Official Symbol: NKRF
Synonyms: NKRF; NFKB repressing factor; NF kappaB repressing factor; NF-kappa-B-repressing factor; ITBA4; NRF;
Gene ID: 55922
mRNA Refseq: NM_001173487
Protein Refseq: NP_001166958
MIM: 300440
Uniprot ID: O15226
Chromosome Location: Xq24
Function: DNA binding; double-stranded RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.