"NODAL" Related Products

Expand

Recombinant Human NODAL

Cat.No.: NODAL-30448TH
Product Overview: Recombinant fragment, corresponding to amino acids 275-346 of Human Nodal, with an N-terminal proprietary tag, predicted MWt 33.55kDa
Description: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.
Protein length: 72 amino acids
Molecular Weight: 33.550kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Sequence Similarities: Belongs to the TGF-beta family.
Gene Name: NODAL nodal homolog (mouse) [ Homo sapiens ]
Official Symbol: NODAL
Synonyms: NODAL; nodal homolog (mouse); nodal, mouse, homolog; nodal homolog;
Gene ID: 4838
mRNA Refseq: NM_018055
Protein Refseq: NP_060525
MIM: 601265
Uniprot ID: Q96S42
Chromosome Location: 10q22.1
Pathway: Developmental Biology, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function: cytokine activity; growth factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.