"NR5A1" Related Products

Expand
Expand

Recombinant Human NR5A1

Cat.No. : NR5A1-31465TH
Product Overview : Recombinant full length Human Steroidogenic Factor 1 with N terminal proprietary tag; Predicted MWt 76.78 kDa.
Description : The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.
Protein length : 461 amino acids
Molecular Weight : 76.780kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRT VQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRL EAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGP LGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEP YASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA RRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKE GSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAA LLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHK HLGNEMPRNNLLIEMLQAKQT
Sequence Similarities : Belongs to the nuclear hormone receptor family. NR5 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name : NR5A1 nuclear receptor subfamily 5, group A, member 1 [ Homo sapiens ]
Official Symbol : NR5A1
Synonyms : NR5A1; nuclear receptor subfamily 5, group A, member 1; FTZF1; steroidogenic factor 1; AD4BP; ELP; FTZ1; SF 1;
Gene ID : 2516
mRNA Refseq : NM_004959
Protein Refseq : NP_004950
Uniprot ID : Q13285
Chromosome Location : 9q33
Pathway : Androgen Receptor Signaling Pathway, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem;
Function : DNA binding; chromatin binding; double-stranded DNA binding; enzyme binding; ligand-dependent nuclear receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.