Recombinant Human NUCB1, His-tagged
Cat.No. : | NUCB1-28431TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 274-461 of Human Nucleobindin 1, linked to a N-terminal His tag; 45kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 109 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVT LEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRFE EELAAREAELNAKAQRLSQETEALGRSQGRLEAQKREL QQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTDDV PVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL |
Gene Name : | NUCB1 nucleobindin 1 [ Homo sapiens ] |
Official Symbol : | NUCB1 |
Synonyms : | NUCB1; nucleobindin 1; nucleobindin-1; Calnuc; NUC; |
Gene ID : | 4924 |
mRNA Refseq : | NM_006184 |
Protein Refseq : | NP_006175 |
MIM : | 601323 |
Uniprot ID : | Q02818 |
Chromosome Location : | 19q13.33 |
Function : | DNA binding; calcium ion binding; |
Products Types
◆ Recombinant Protein | ||
NUCB1-1558H | Recombinant Human NUCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUCB1-6244M | Recombinant Mouse NUCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUCB1-3770R | Recombinant Rat NUCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nucb1-4527M | Recombinant Mouse Nucb1 Protein, Myc/DDK-tagged | +Inquiry |
NUCB1-1394H | Recombinant Human NUCB1, His-tagged | +Inquiry |
◆ Lysates | ||
NUCB1-3659HCL | Recombinant Human NUCB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket