Recombinant Human ODC1
Cat.No. : | ODC1-30519TH |
Product Overview : | Recombinant full length Human Ornithine Decarboxylase with N terminal proprietary tag, 76.82kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. |
Protein length : | 461 amino acids |
Molecular Weight : | 76.820kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAF YVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTL AATGAGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGS GCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVND GVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGF QRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVS CAWESGMKRHRAACASASINV |
Sequence Similarities : | Belongs to the Orn/Lys/Arg decarboxylase class-II family. |
Gene Name : | ODC1 ornithine decarboxylase 1 [ Homo sapiens ] |
Official Symbol : | ODC1 |
Synonyms : | ODC1; ornithine decarboxylase 1; ornithine decarboxylase; ODC; |
Gene ID : | 4953 |
mRNA Refseq : | NM_002539 |
Protein Refseq : | NP_002530 |
MIM : | 165640 |
Uniprot ID : | P11926 |
Chromosome Location : | 2p25 |
Pathway : | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | lyase activity; ornithine decarboxylase activity; |
Products Types
◆ Recombinant Protein | ||
Odc1-4572M | Recombinant Mouse Odc1 Protein, Myc/DDK-tagged | +Inquiry |
ODC1-6313M | Recombinant Mouse ODC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Odc1-1883R | Recombinant Rat Odc1 Protein, His-tagged | +Inquiry |
ODC1-1573H | Recombinant Human ODC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ODC1-2974R | Recombinant Rhesus Macaque ODC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
ODC1-3600HCL | Recombinant Human ODC1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionAltered ODC1 activity is linked to cancer progression, as polyamines are vital for rapid cell division.
Targeting ODC1 offers potential for cancer therapy by controlling polyamine levels in rapidly dividing cells.
ODC1 is involved in tissue repair processes, aiding in cell regeneration and healing.
ODC1 works with other metabolic enzymes, coordinating the synthesis and regulation of polyamines.
ODC1, ornithine decarboxylase, is crucial for initiating polyamine synthesis, essential for cellular growth and function.
It plays a key role in cell proliferation by providing polyamines necessary for DNA and protein synthesis.
Genetic variations in ODC1 can lead to differences in polyamine synthesis, affecting cell growth and metabolism.
Customer Reviews (3)
Write a reviewEnhances research credibility, a dependable research ally.
Critical for decision-making, a vital research resource.
Efficiency and precision, accelerates research timelines.
Ask a Question for All ODC1 Products
Required fields are marked with *
My Review for All ODC1 Products
Required fields are marked with *
Inquiry Basket