Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ODC1

Cat.No. : ODC1-30519TH
Product Overview : Recombinant full length Human Ornithine Decarboxylase with N terminal proprietary tag, 76.82kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter.
Protein length : 461 amino acids
Molecular Weight : 76.820kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAF YVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTL AATGAGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGS GCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVND GVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGF QRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVS CAWESGMKRHRAACASASINV
Sequence Similarities : Belongs to the Orn/Lys/Arg decarboxylase class-II family.
Gene Name : ODC1 ornithine decarboxylase 1 [ Homo sapiens ]
Official Symbol : ODC1
Synonyms : ODC1; ornithine decarboxylase 1; ornithine decarboxylase; ODC;
Gene ID : 4953
mRNA Refseq : NM_002539
Protein Refseq : NP_002530
MIM : 165640
Uniprot ID : P11926
Chromosome Location : 2p25
Pathway : Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : lyase activity; ornithine decarboxylase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What is the impact of altered ODC1 activity on cancer development? 02/28/2021

Altered ODC1 activity is linked to cancer progression, as polyamines are vital for rapid cell division.

What potential therapeutic applications arise from targeting ODC1 in cancer treatment? 10/22/2020

Targeting ODC1 offers potential for cancer therapy by controlling polyamine levels in rapidly dividing cells.

What role does ODC1 play in tissue repair? 10/27/2018

ODC1 is involved in tissue repair processes, aiding in cell regeneration and healing.

How does ODC1 interact with other enzymes in polyamine metabolism? 08/26/2018

ODC1 works with other metabolic enzymes, coordinating the synthesis and regulation of polyamines.

What is the primary role of ODC1 in polyamine synthesis? 12/29/2017

ODC1, ornithine decarboxylase, is crucial for initiating polyamine synthesis, essential for cellular growth and function.

How does ODC1 contribute to cell growth and proliferation? 08/01/2017

It plays a key role in cell proliferation by providing polyamines necessary for DNA and protein synthesis.

How do genetic variations in ODC1 affect cellular metabolism? 07/17/2017

Genetic variations in ODC1 can lead to differences in polyamine synthesis, affecting cell growth and metabolism.

Customer Reviews (3)

Write a review
Reviews
10/27/2018

    Enhances research credibility, a dependable research ally.

    12/29/2017

      Critical for decision-making, a vital research resource.

      08/01/2017

        Efficiency and precision, accelerates research timelines.

        Ask a Question for All ODC1 Products

        Required fields are marked with *

        My Review for All ODC1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends