Recombinant Human OLFM1, His-tagged

• Cat.No.: OLFM1-30337TH
• Product Overview: Recombinant fragment, corresponding to amino acids 33-125 of Human Noelin Isoform 4 with N terminal His tag; Predicted MWt 12 kDa.

Specification

• Description: This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 126 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK VQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQ VEESHKQHLARQFKG
• Sequence Similarities: Contains 1 olfactomedin-like domain.

Gene Information

• Gene Name: OLFM1 olfactomedin 1 [ Homo sapiens ]
• Official Symbol: OLFM1
• Synonyms: OLFM1; olfactomedin 1; noelin; AMY; NOE1; NOELIN; OlfA
• Gene ID: 10439
• mRNA Refseq: NM_006334
• Protein Refseq: NP_006325
• MIM: 605366
• Uniprot ID: Q99784
• Chromosome Location: 9q34.3
• Function: protein binding