"OSTF1" Related Products

Expand

Recombinant Human OSTF1, His-tagged

Cat.No.: OSTF1-28124TH
Product Overview: Recombinant full length Human OSTF1 with C terminal His tag; 222 amino acids with a predicted MWt 25.1 kDa including tag.
Description: Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al.
Protein length: 214 amino acids
Conjugation: HIS
Molecular Weight: 25.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitously expressed. Present in osteoclasts (at protein level).
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.24% Tris, 0.01% DTT, 10% Glycerol
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELYFEEGD IIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPL HEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGG HKDIVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQ LFLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDA VRTLSNAEDYLDDEDSDLEHHHHHH
Sequence Similarities: Contains 3 ANK repeats.Contains 1 SH3 domain.
Gene Name: OSTF1 osteoclast stimulating factor 1 [ Homo sapiens ]
Official Symbol: OSTF1
Synonyms: OSTF1; osteoclast stimulating factor 1; osteoclast-stimulating factor 1; bA235O14.1; OSF; SH3P2;
Gene ID: 26578
mRNA Refseq: NM_012383
Protein Refseq: NP_036515
MIM: 610180
Uniprot ID: Q92882
Chromosome Location: 9q13-q21.2
Function: SH3 domain binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.