Recombinant Human OTUB2, His-tagged
Cat.No. : | OTUB2-30525TH |
Product Overview : | Recombinant full length protein, (amino acids 1-234) of Human OTUB2 with N terminal His tag; 254 amino acids, 29.4 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. |
Protein length : | 234 amino acids |
Conjugation : | HIS |
Molecular Weight : | 29.400kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Widely expressed. Expressed at higher level in brain. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.29% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSETSFNLISEKCDILSILR DHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSY LESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFN AFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQI TALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLY KTSHYNILYAADKH |
Sequence Similarities : | Belongs to the peptidase C65 family.Contains 1 OTU domain. |
Gene Name : | OTUB2 OTU domain, ubiquitin aldehyde binding 2 [ Homo sapiens ] |
Official Symbol : | OTUB2 |
Synonyms : | OTUB2; OTU domain, ubiquitin aldehyde binding 2; C14orf137, chromosome 14 open reading frame 137; ubiquitin thioesterase OTUB2; FLJ21916; MGC3102; |
Gene ID : | 78990 |
mRNA Refseq : | NM_023112 |
Protein Refseq : | NP_075601 |
MIM : | 608338 |
Uniprot ID : | Q96DC9 |
Chromosome Location : | 14q32.13-q32.2 |
Function : | cysteine-type peptidase activity; omega peptidase activity; peptidase activity; ubiquitin-specific protease activity; ubiquitin-specific protease activity; |
Products Types
◆ Recombinant Protein | ||
OTUB2-13HFL | Active Recombinant Full Length Human OTUB2 Protein, N-His tagged | +Inquiry |
OTUB2-354H | Recombinant Human OTUB2 Protein, GST-tagged | +Inquiry |
OTUB2-353H | Recombinant Human OTUB2 Protein | +Inquiry |
Otub2-4625M | Recombinant Mouse Otub2 Protein, Myc/DDK-tagged | +Inquiry |
OTUB2-64H | Recombinant Human OTUB2, His-tagged | +Inquiry |
◆ Lysates | ||
OTUB2-3515HCL | Recombinant Human OTUB2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket