Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PAEP

Cat.No. : PAEP-31025TH
Product Overview : Recombinant full length Human Placental Protein 14 / Glycodelin A with an N terminal proprietary tag; Predicted MWt 45.87 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. A number of alternatively spliced transcript variants have been observed at this locus, but the full-length nature of only two, each encoding the same protein, has been determined.
Protein length : 180 amino acids
Molecular Weight : 45.870kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSM AMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWE NNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRP LPRHLWYLLDLKQMEEPCRF
Sequence Similarities : Belongs to the calycin superfamily. Lipocalin family.
Gene Name : PAEP progestagen-associated endometrial protein [ Homo sapiens ]
Official Symbol : PAEP
Synonyms : PAEP; progestagen-associated endometrial protein; glycodelin; alpha uterine protein; GD; GdA; GdF; GdS; glycodelin A; glycodelin F; glycodelin S; MGC138509; MGC142288; PAEG; PEP; PP14; PP14 protein (placental protein 14); pregnancy associated endometrial
Gene ID : 5047
mRNA Refseq : NM_001018049
Protein Refseq : NP_001018059
MIM : 173310
Uniprot ID : P09466
Chromosome Location : 9q34
Function : binding; transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Are there any limitations or challenges associated with using PAEP protein in clinical settings? 12/21/2021

Challenges may include variations in individual PAEP levels and the need for standardized assays for accurate measurements.

Can PAEP protein be used as a marker for recurrent pregnancy loss? 05/31/2020

Some studies suggest a potential association between low PAEP levels and recurrent pregnancy loss, but more research is needed to establish a definitive link.

How does PAEP protein contribute to the understanding of endometrial function? 04/13/2019

PAEP's expression and regulation in the endometrium provide insights into the complex processes involved in implantation and endometrial function.

How is PAEP protein utilized in monitoring high-risk pregnancies? 01/10/2019

Elevated or reduced PAEP levels may indicate a risk of complications during pregnancy, such as preeclampsia, allowing for early intervention and management.

Can PAEP protein be a target for therapeutic interventions in reproductive medicine? 02/17/2016

Research suggests that manipulating PAEP levels may have therapeutic potential in addressing certain reproductive disorders, though further studies are needed.

Customer Reviews (3)

Write a review
Reviews
08/11/2020

    With the manufacturer's outstanding technical support, you can be assured that any challenges you encounter will be efficiently addressed.

    05/04/2020

      Its superior quality, combined with the manufacturer's exceptional technical support, provides researchers with the confidence they need to conduct successful experiments and obtain meaningful results.

      01/02/2019

        Researchers who have utilized the PAEP protein laud its reliability and effectiveness in their studies.

        Ask a Question for All PAEP Products

        Required fields are marked with *

        My Review for All PAEP Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends