Recombinant Human PAEP
Cat.No. : | PAEP-31025TH |
Product Overview : | Recombinant full length Human Placental Protein 14 / Glycodelin A with an N terminal proprietary tag; Predicted MWt 45.87 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. A number of alternatively spliced transcript variants have been observed at this locus, but the full-length nature of only two, each encoding the same protein, has been determined. |
Protein length : | 180 amino acids |
Molecular Weight : | 45.870kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSM AMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWE NNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRP LPRHLWYLLDLKQMEEPCRF |
Sequence Similarities : | Belongs to the calycin superfamily. Lipocalin family. |
Gene Name : | PAEP progestagen-associated endometrial protein [ Homo sapiens ] |
Official Symbol : | PAEP |
Synonyms : | PAEP; progestagen-associated endometrial protein; glycodelin; alpha uterine protein; GD; GdA; GdF; GdS; glycodelin A; glycodelin F; glycodelin S; MGC138509; MGC142288; PAEG; PEP; PP14; PP14 protein (placental protein 14); pregnancy associated endometrial |
Gene ID : | 5047 |
mRNA Refseq : | NM_001018049 |
Protein Refseq : | NP_001018059 |
MIM : | 173310 |
Uniprot ID : | P09466 |
Chromosome Location : | 9q34 |
Function : | binding; transporter activity; |
Products Types
◆ Recombinant Protein | ||
PAEP-1893H | Recombinant Human PAEP Protein, His&GST-tagged | +Inquiry |
PAEP-3100R | Recombinant Rhesus Macaque PAEP Protein, His (Fc)-Avi-tagged | +Inquiry |
PAEP-7563H | Recombinant Human PAEP, His-tagged | +Inquiry |
PAEP-0034B | Recombinant Bovine PAEP Protein (Lys17-Ile178), N-His-tagged | +Inquiry |
PAEP-5750P | Recombinant Pig PAEP protein, His & T7-tagged | +Inquiry |
◆ Native Protein | ||
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
◆ Lysates | ||
PAEP-3470HCL | Recombinant Human PAEP 293 Cell Lysate | +Inquiry |
PAEP-3469HCL | Recombinant Human PAEP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionChallenges may include variations in individual PAEP levels and the need for standardized assays for accurate measurements.
Some studies suggest a potential association between low PAEP levels and recurrent pregnancy loss, but more research is needed to establish a definitive link.
PAEP's expression and regulation in the endometrium provide insights into the complex processes involved in implantation and endometrial function.
Elevated or reduced PAEP levels may indicate a risk of complications during pregnancy, such as preeclampsia, allowing for early intervention and management.
Research suggests that manipulating PAEP levels may have therapeutic potential in addressing certain reproductive disorders, though further studies are needed.
Customer Reviews (3)
Write a reviewWith the manufacturer's outstanding technical support, you can be assured that any challenges you encounter will be efficiently addressed.
Its superior quality, combined with the manufacturer's exceptional technical support, provides researchers with the confidence they need to conduct successful experiments and obtain meaningful results.
Researchers who have utilized the PAEP protein laud its reliability and effectiveness in their studies.
Ask a Question for All PAEP Products
Required fields are marked with *
My Review for All PAEP Products
Required fields are marked with *
Inquiry Basket