"PAM" Related Products

Expand

Recombinant Human PAM

Cat.No.: PAM-30777TH
Product Overview: Recombinant full length Human PAM isoform 2 , with N terminal proprietary tag; Predicted MW 121.26kDa.
Description: This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.
Protein length: 866 amino acids
Molecular Weight: 121.260kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAGRVPSLLVLLVFPSSCLAFRSPLSVFKRFKETTRPFSN ECLGTTRPVVPIDSSDFALDIRMPGVTPKQSDTYFCMSMR IPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWF CDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSK YFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMY LMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTHH LGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSF GDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEA KHAVSFMTCTQNVAPDMFRTIPPEANIPIPVKSDMVMMHE HHKETEYKDKIPLLQQPKREEEEVLDQDFHMEEALDWPGV YLLPGQVSGVALDPKNNLVIFHRGDHVWDGNSFDSKFVYQ QIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSID KDGNYWVTDVALHQVFKLDPNNKEGPVLILGRSMQPGSDQ NHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFIT QWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGR IQCFKTDTKEFVREIKHSSFGRNVFAISYIPGLLFAVNGK PHFGDQEPVQGFVMNFSNGEIIDIFKPVRKHFDMPHDIVA SEDGTVYIGDAHTNTVWKFTLTEKLEHRSVKKAGIEVQEI KEAEAVVETKMENKPTSSELQKMQEKQKLIKEPGSGVPVV LITTLLVIPVVVLLAIAIFIRWKKSRAFGDSEHKLETSSG RVLGRFRGKGSGGLNLGNFFASRKGYSRKGFDRLSTEGSD QEKEDDGSESEEEYSAPLPALAPSSS
Sequence Similarities: In the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 5 NHL repeats.
Gene Name: PAM peptidylglycine alpha-amidating monooxygenase [ Homo sapiens ]
Official Symbol: PAM
Synonyms: PAM; peptidylglycine alpha-amidating monooxygenase; peptidyl-glycine alpha-amidating monooxygenase; PAL; peptidyl alpha hydroxyglycine alpha amidating lyase; peptidylglycine alpha hydroxylating monooxygenase; PHM;
Gene ID: 5066
mRNA Refseq: NM_000919
Protein Refseq: NP_000910
MIM: 170270
Uniprot ID: P19021
Chromosome Location: 5q
Function: L-ascorbic acid binding; copper ion binding; lyase activity; metal ion binding; peptidylamidoglycolate lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.