Recombinant Human PAX7

• Cat.No.: PAX7-29057TH
• Product Overview: Recombinant fragment of Human PAX7 with N terminal proprietary tag, 38.21kDa inclusive of tag.

Specification

• Description: This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene.
• Protein length: 111 amino acids
• Molecular Weight: 38.210kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT GYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCL FMESYKVVSGWGMSISQMEKLKSSQMEQFT
• Sequence Similarities: Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.Contains 1 paired domain.

Gene Information

• Gene Name: PAX7 paired box 7 [ Homo sapiens ]
• Official Symbol: PAX7
• Synonyms: PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1
• Gene ID: 5081
• mRNA Refseq: NM_001135254
• Protein Refseq: NP_001128726
• MIM: 167410
• Uniprot ID: P23759
• Chromosome Location: 1p36.13
• Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity