"PCSK5" Related Products

Recombinant Human PCSK5 protein, GST-tagged

Cat.No.: PCSK5-30549TH
Product Overview: Recombinant Human PCSK5(804 a.a. - 913 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.84 kDa
AA Sequence: TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATE ESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PCSK5 proprotein convertase subtilisin/kexin type 5 [ Homo sapiens ]
Official Symbol: PCSK5
Synonyms: PCSK5; proprotein convertase subtilisin/kexin type 5; PC5; PC6; SPC6; hPC6; protease PC6; prohormone convertase 5; proprotein convertase 6; subtilisin/kexin-like protease PC5; PC6A; FLJ11149; FLJ16215;
Gene ID: 5125
mRNA Refseq: NM_006200
Protein Refseq: NP_006191
MIM: 600488
UniProt ID: Q92824
Chromosome Location: 9q21.3
Pathway: NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signalling by NGF, organism-specific biosystem;
Function: peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type endopeptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.