"PCSK5" Related Products

Recombinant Human PCSK5 protein, GST-tagged

Cat.No.: PCSK5-30549TH
Product Overview: Recombinant Human PCSK5(804 a.a. - 913 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.84 kDa
AA Sequence: TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATE ESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PCSK5 proprotein convertase subtilisin/kexin type 5 [ Homo sapiens ]
Official Symbol: PCSK5
Synonyms: PCSK5; proprotein convertase subtilisin/kexin type 5; PC5; PC6; SPC6; hPC6; protease PC6; prohormone convertase 5; proprotein convertase 6; subtilisin/kexin-like protease PC5; PC6A; FLJ11149; FLJ16215;
Gene ID: 5125
mRNA Refseq: NM_006200
Protein Refseq: NP_006191
MIM: 600488
UniProt ID: Q92824
Chromosome Location: 9q21.3
Pathway: NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signalling by NGF, organism-specific biosystem;
Function: peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type endopeptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.