"PCYT1A" Related Products

Recombinant Human PCYT1A

Cat.No.: PCYT1A-29484TH
Product Overview: Recombinant full length Human PCYT1A with N terminal proprietary tag; Predicted MW 66.44 kDa.
Protein length: 367 amino acids
Molecular Weight: 66.440kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVG LRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVY ADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAE HRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGI STSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKY HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE KSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSP SSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYD ISEDEED
Sequence Similarities: Belongs to the cytidylyltransferase family.
Gene Name: PCYT1A phosphate cytidylyltransferase 1, choline, alpha [ Homo sapiens ]
Official Symbol: PCYT1A
Synonyms: PCYT1A; phosphate cytidylyltransferase 1, choline, alpha; PCYT1, phosphate cytidylyltransferase 1, choline, alpha isoform; choline-phosphate cytidylyltransferase A; CT; CTPCT; phosphate cytidylyltransferase 1; choline; alpha isoform;
Gene ID: 5130
mRNA Refseq: NM_005017
Protein Refseq: NP_005008
MIM: 123695
Uniprot ID: P49585
Chromosome Location: 3q29
Pathway: Acetylcholine Synthesis, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Phosphatidylcholine (PC) biosynthesis, choline =>
Function: choline-phosphate cytidylyltransferase activity; lipid binding; nucleotidyltransferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.