Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PDCD1

Cat.No. : PDCD1-29487TH
Product Overview : Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
Sequence Similarities : Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name : PDCD1 programmed cell death 1 [ Homo sapiens ]
Official Symbol : PDCD1
Synonyms : PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1;
Gene ID : 5133
mRNA Refseq : NM_005018
Protein Refseq : NP_005009
MIM : 600244
Uniprot ID : Q15116
Chromosome Location : 2q37.3
Pathway : Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : protein binding; protein tyrosine phosphatase activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (14)

Ask a question
What are the mechanisms by which PDCD1 modulates the immune response to viral infections? 07/31/2022

PDCD1 modulates responses to viral infections, affecting T cell function and viral clearance.

What are the mechanisms by which PDCD1 modulates the immune response to viral infections? 11/09/2021

PDCD1 modulates responses to viral infections, affecting T cell function and viral clearance.

What role does PDCD1 play in the development of immune tolerance? 10/15/2021

PDCD1 helps develop immune tolerance, preventing overactive immune responses.

How does PDCD1 influence the balance between immune activation and autoimmunity? 05/23/2021

PDCD1 maintains a balance between immune response and autoimmunity, preventing self-reactivity.

How does PDCD1 contribute to the exhaustion of T cells in chronic infections and cancer? 08/13/2020

PDCD1 contributes to T cell exhaustion in chronic diseases and cancers, reducing immune efficacy.

How does PDCD1 influence the balance between immune activation and autoimmunity? 08/05/2020

PDCD1 maintains a balance between immune response and autoimmunity, preventing self-reactivity.

What is the impact of PDCD1 on the effectiveness of immunotherapy in treating cancers? 12/05/2019

PDCD1's role in immunotherapy is pivotal, as blocking PD-1 enhances anti-tumor responses.

How does PDCD1 contribute to the exhaustion of T cells in chronic infections and cancer? 11/21/2019

PDCD1 contributes to T cell exhaustion in chronic diseases and cancers, reducing immune efficacy.

How does PDCD1 (PD-1) regulate immune checkpoint pathways in T cells? 04/24/2019

PDCD1 regulates T cell activity by inhibiting immune responses, crucial in immune checkpoints.

What is the impact of PDCD1 on the effectiveness of immunotherapy in treating cancers? 01/19/2019

PDCD1's role in immunotherapy is pivotal, as blocking PD-1 enhances anti-tumor responses.

What role does PDCD1 play in the development of immune tolerance? 12/08/2018

PDCD1 helps develop immune tolerance, preventing overactive immune responses.

How do alterations in PDCD1 expression or signaling affect autoimmune disease progression? 06/24/2018

Changes in PDCD1 signaling impact autoimmune disease progression, influencing immune system activity.

How does PDCD1 (PD-1) regulate immune checkpoint pathways in T cells? 06/24/2018

PDCD1 regulates T cell activity by inhibiting immune responses, crucial in immune checkpoints.

How do alterations in PDCD1 expression or signaling affect autoimmune disease progression? 02/06/2018

Changes in PDCD1 signaling impact autoimmune disease progression, influencing immune system activity.

Customer Reviews (3)

Write a review
Reviews
06/06/2021

    Timely antibody validation, a valuable asset for our laboratory.

    02/12/2021

      Precise protein quantification, fundamental for maintaining data accuracy.

      06/20/2019

        Dependable peptide synthesis, accelerates our peptide-based projects effectively.

        Ask a Question for All PDCD1 Products

        Required fields are marked with *

        My Review for All PDCD1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends