"PDCD1" Related Products

Expand
Expand
Expand

Recombinant Human PDCD1

Cat.No.: PDCD1-29487TH
Product Overview: Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.
Description: This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
Sequence Similarities: Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: PDCD1 programmed cell death 1 [ Homo sapiens ]
Official Symbol: PDCD1
Synonyms: PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1;
Gene ID: 5133
mRNA Refseq: NM_005018
Protein Refseq: NP_005009
MIM: 600244
Uniprot ID: Q15116
Chromosome Location: 2q37.3
Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: protein binding; protein tyrosine phosphatase activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.