Recombinant Human PDCD1
Cat.No. : | PDCD1-29487TH |
Product Overview : | Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV |
Sequence Similarities : | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name : | PDCD1 programmed cell death 1 [ Homo sapiens ] |
Official Symbol : | PDCD1 |
Synonyms : | PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1; |
Gene ID : | 5133 |
mRNA Refseq : | NM_005018 |
Protein Refseq : | NP_005009 |
MIM : | 600244 |
Uniprot ID : | Q15116 |
Chromosome Location : | 2q37.3 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function : | protein binding; protein tyrosine phosphatase activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
PDCD1-258H | Active Recombinant Human PDCD1 Protein, Fc-Avi-His-tagged, Biotinylated | +Inquiry |
Pdcd1-4730M | Recombinant Mouse Pdcd1 Protein, Myc/DDK-tagged | +Inquiry |
PDCD1-1173H | Recombinant Human PDCD1 Protein, His-tagged | +Inquiry |
PDCD1-700M | Recombinant Mouse PDCD1 Protein, IgG2a Fc-tagged | +Inquiry |
PDCD1-697H | Recombinant Human PDCD1 Protein | +Inquiry |
◆ Lysates | ||
PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (14)
Ask a questionPDCD1 modulates responses to viral infections, affecting T cell function and viral clearance.
PDCD1 modulates responses to viral infections, affecting T cell function and viral clearance.
PDCD1 helps develop immune tolerance, preventing overactive immune responses.
PDCD1 maintains a balance between immune response and autoimmunity, preventing self-reactivity.
PDCD1 contributes to T cell exhaustion in chronic diseases and cancers, reducing immune efficacy.
PDCD1 maintains a balance between immune response and autoimmunity, preventing self-reactivity.
PDCD1's role in immunotherapy is pivotal, as blocking PD-1 enhances anti-tumor responses.
PDCD1 contributes to T cell exhaustion in chronic diseases and cancers, reducing immune efficacy.
PDCD1 regulates T cell activity by inhibiting immune responses, crucial in immune checkpoints.
PDCD1's role in immunotherapy is pivotal, as blocking PD-1 enhances anti-tumor responses.
PDCD1 helps develop immune tolerance, preventing overactive immune responses.
Changes in PDCD1 signaling impact autoimmune disease progression, influencing immune system activity.
PDCD1 regulates T cell activity by inhibiting immune responses, crucial in immune checkpoints.
Changes in PDCD1 signaling impact autoimmune disease progression, influencing immune system activity.
Customer Reviews (3)
Write a reviewTimely antibody validation, a valuable asset for our laboratory.
Precise protein quantification, fundamental for maintaining data accuracy.
Dependable peptide synthesis, accelerates our peptide-based projects effectively.
Ask a Question for All PDCD1 Products
Required fields are marked with *
My Review for All PDCD1 Products
Required fields are marked with *
Inquiry Basket