"PDCD6" Related Products

Expand
Expand

Recombinant Human PDCD6, His-tagged

Cat.No.: PDCD6-30798TH
Product Overview: Recombinant full length Human PDCD6 with an N terminal His tag; 211 amino acids with the tag, predicted mwt: 24 kDa.
Description: This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant.
Protein length: 191 amino acids
Conjugation: HIS
Molecular Weight: 24.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 10mM Sodium citrate, pH 3.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Sequence Similarities: Contains 5 EF-hand domains.
Gene Name: PDCD6 programmed cell death 6 [ Homo sapiens ]
Official Symbol: PDCD6
Synonyms: PDCD6; programmed cell death 6; programmed cell death protein 6; ALG 2; apoptosis linked gene 2; PEF1B;
Gene ID: 10016
mRNA Refseq: NM_013232
Protein Refseq: NP_037364
MIM: 601057
Uniprot ID: O75340
Chromosome Location: 5p15.33
Function: binding, bridging; calcium ion binding; calcium ion binding; calcium-dependent protein binding; calcium-dependent protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.