"PDHA1" Related Products

Expand
Expand
Expand

Recombinant Human PDHA1 protein, His-tagged

Cat.No.: PDHA1-28668TH
Product Overview: Recombinant Human PDHA1 fussed with His tag was expressed in E. coli.
Description: The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle. The PDH complex is composed of multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). The E1 enzyme is a heterotetramer of two alpha and two beta subunits. This gene encodes the E1 alpha 1 subunit containing the E1 active site, and plays a key role in the function of the PDH complex. Mutations in this gene are associated with pyruvate dehydrogenase E1-alpha deficiency and X-linked Leigh syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source: E. coli
Species: Human
Tag: His
Form: Lyophilised. 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5.
AA Sequence: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP PVT TVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE ACCVGLEA GINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCA KGKGGSMHMYAKN FYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLY GDGAANQGQIFEAYNMAA LWKLPCIFICENNRYGMGTSVERAAASTDY YKRGDFIPGLRVDGMDILCVREA TRFAAAYCRSGKGPILMELQTYRYH GHSMSDPGVSYRTREEIQEVRSKSDPIM LLKDRMVNSNLASVEELKEI DVEVRKEIEDAAQFATADPEPPLEELGYHIYSS DPPFEVRGANQWIKF KSVS
Applications: Western blot; Mass Spectrometry; SDS-PAGE
Stability: Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Reconstitution: Reconstitute with 160 µl aqua dest.
Gene Name: PDHA1 pyruvate dehydrogenase (lipoamide) alpha 1 [ Homo sapiens ]
Official Symbol: PDHA1
Synonyms: PDHA; PDHAD; PHE1A; PDHCE1A; pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; pyruvate dehydrogenase E1 subunit; pyruvate dehydrogenase complex, E1-alpha polypeptide 1
Gene ID: 5160
mRNA Refseq: NM_000284
Protein Refseq: NP_000275
MIM: 300502
UniProt ID: P08559
Chromosome Location: Xp22.1
Pathway: Acetylcholine Synthesis, organism-specific biosystem; Biosynthesis of antibiotics, organism-specific biosystem; Central carbon metabolism in cancer, organism-specific biosystem
Function: pyruvate dehydrogenase (acetyl-transferring) activity; pyruvate dehydrogenase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.